General Information

  • ID:  hor005727
  • Uniprot ID:  P01299
  • Protein name:  Pancreatic icosapeptide
  • Gene name:  PPY
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DRGEMRDILEWGSPHAAAPR
  • Length:  20
  • Propeptide:  MPAACRCLFLLLLSACVALLLQPPLGTRGAPLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRYGKRDRGEMRDILEWGSPHAAAPRELMDE
  • Signal peptide:  MPAACRCLFLLLLSACVALLLQPPLGTRG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.; The physiological role for the icosapeptide has not yet been elucidated.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01299-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005727_AF2.pdbhor005727_ESM.pdb

Physical Information

Mass: 260359 Formula: C96H150N32O30S
Absent amino acids: CFKNQTVY Common amino acids: AR
pI: 5.6 Basic residues: 4
Polar residues: 3 Hydrophobic residues: 6
Hydrophobicity: -104 Boman Index: -6205
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 54
Instability Index: 1870.5 Extinction Coefficient cystines: 5500
Absorbance 280nm: 289.47

Literature

  • PubMed ID:  3827854
  • Title:  Cat pancreatic eicosapeptide and its biosynthetic intermediate. Conservation of a monobasic processing site.